Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

INFINITY

INFINITY - Synergy Ceramic Wax 200ML

Part: BRNICLSCW200

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£100.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

INFINITY - Synergy Ceramic Wax 200ML

What we say:

Probably the best synthetic wax to date! This very durable high active ceramic wax contains more than meets the eye! Combining the powerful ceramic resins and binders found in the Synergy coating we have blended in an extremely high melting point technical mixture of modified polyethylene, Flourine derived polymer which is loosely related to PTFE, and 2 solid Si02 polymers to create this masterpiece.

Famed in testing for its mind-blowing water behavior, Synergy wax is also at the time of publishing this, capable of 58 weeks durability and counting, the recent tests showed water contact angles of 106 at this point and a maximum of 124 12 hours after initial application. We expect 14 months from this product and will revisit this section in due course.

This wax has a high resistance to detergents and is completely unaffected by temperatures, making it an ideal winter protection wax. A 200ML pot will cover 25 vehicles on average.

Application Instructions:

1. Prepare the surface before waxing by removing previous waxes and sealants. The best way to do this is by light machine polish, an example would be Scholl Concepts S40 with a soft pad. Followed by a thorough wipe down using an alcohol-based panel wipe like isopropanol.

2. Take 1-2 swipes from the pot, only use soft foam to apply this wax. Once you have loaded the applicator proceed to press it over a small area of the panel several times, this creates an even application by collecting more wax as you work across the panel. Always ensure an even thin layer is applied, over-application will have negative effects on removal and performance.

3. Remove the wax with a short pile towel like our blue removal coth after 1-5 minutes maximum, this means only 1 panel at a time. It is normal to see a hazy residue after initial removal. Removing this residue is done by using our plush yellow buffing towel, wipe in straight lines to ensure the light residue has been removed.

4. After application, allow 3 hours for this wax to bond before wetting the vehicle, and do not wash for 7 days after application.

Safety precautions:

Always wear gloves when using this wax, in some confined spaces you may wish to use a mask for application. If drowsiness or headaches start to occur stop using and move to an area of fresh air.

If any skin irritation develops stop using, remove clothing which may be contaminated and wash the skin with cold soapy water only, begin to introduce gentle scrubbing unless the skin is broken. If in any doubt seek medical advice and show the product MSDS sheet.

Storage considerations:

Always store this wax in a cool area where temperature fluctuations are minimal.

Info

Brand

INFINITY

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!