Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Engine Oil

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
comma

COMMA - Engine Oil Syner-X 5W-30 - 1L

Part: COMSYX1L

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£15.74

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

COMMA - Engine Oil Syner-X 5W-30 - 1L

Comma is a trusted British brand with a strong reputation for delivering high-quality, technically advanced lubricants. The Comma Syner-X range represents a premium line of fully synthetic engine oils, designed to meet the demands of modern high-performance petrol and diesel vehicles, including those fitted with the latest emissions systems and fuel-saving technologies.

Key Features of Comma Syner-X Engine Oils:

  • Fully synthetic performance – Offers maximum protection, excellent low-temperature flow, and outstanding high-temperature stability.

  • Engineered for modern vehicles – Ideal for engines with turbochargers, direct injection, DPFs, and catalytic converters.

  • Enhanced fuel efficiency – Low-friction formulations help improve fuel economy and reduce carbon emissions.

  • Superior cleanliness and wear control – Keeps engines clean while providing long-lasting protection against wear and deposits.

  • Meets leading OEM specifications – Approved for use in vehicles from major manufacturers, ensuring compatibility and performance.

Whether you're maintaining a premium vehicle or aiming for extended engine life, Comma Syner-X oils deliver the high-level protection and performance today’s engines demand.

Fitment Info

Size

1L

Type

Semi Synthetic Oil

Brand

comma

Packing Type

Bottle

Specification

API SN, ILSAC GF-5

Oil - manufacturer recommendation 1

Dexos 1 Gen 2

Oil - manufacturer recommendation 2

Ford WSS-M2C946-A

Oil - manufacturer recommendation 3

GM 6094M/4718M

Oil - manufacturer recommendation 4

Chrysler MS6395

Oil - manufacturer recommendation 5

Fiat 9.55535-CR1

Grade

5W-30

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!