Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

WD40

WD40 - Specialist Contact Cleaner

Part: WDF44376

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£8.59

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

WD40 - Specialist Contact Cleaner

WD-40 Specialist Contact Cleaner delivers exceptional cleaning performance with precision and care. Renowned for its advanced formulation and Smart Straw technology, this contact cleaner effectively removes oil, dirt, flux residue, and condensation from sensitive electronics and electrical components. Trusted for its quick-drying, residue-free results, it ensures optimal operation of circuits and controls, maintaining reliability and safety across various automotive and electronic applications.

Engineered for excellence, its fast evaporation and broad compatibility with plastics, rubber, and metals provide versatile maintenance benefits.

Features:

  • Precision Cleaning: Targets sensitive electronic surfaces
  • Residue-Free: Leaves no contaminating film
  • Quick Drying: Minimises downtime and enhances efficiency
  • Multi-Surface Safe: Compatible with plastics, rubber, and metal
  • Advanced Technology: Patented Smart Straw for pinpoint application


Reliable performance and superior cleaning efficacy support long-lasting equipment functionality and protection. Designed to meet rigorous standards, it offers peace of mind through consistent, professional-grade maintenance results aligned with industry expectations.

Info

Brand

WD40

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!