Truck

Free Delivery - For orders above £25

Kalarna

Klarna - Pay in 30 Days

POWERMAXED - Shampoo and Ultra Wax Concentrate - 5L

powermaxed

POWERMAXED - Shampoo and Ultra Wax Concentrate - 5L

Part: STLCSUW5000

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£20.88

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

POWERMAXED - Shampoo and Ultra Wax Concentrate - 5L

Power Maxed Shampoo & Ultra Wax 5L

Power Maxed Shampoo & Ultra Wax is a vehicle shampoo for removing stubborn contaminants which aren t already removed by a touchless wash.

This is the bit where you get hands-on, caressing your vehicle with the best value shampoo and wax, meaning you can thoroughly clean and wax your car too, with minimal effort.

Shampoo & Ultra Wax contains foam boosters and strong detergents to easily lift dirt away from the surface of the vehicle, meaning minimal scrubbing is required, which means happier paintwork.

The foam keeps any lifted contaminants suspended away from the paintwork ready to harmlessly be rinsed away. It also contains Carnauba wax which it leaves behind as a protective residue, leaving your vehicle looking glossy and the paintwork protected against contaminants such as water spots and bug splats. This also aids rinsing.

Used at the recommended dilution rate, the vehicle will be finished completely streak-free.

Info

Brand

powermaxed

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!