Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

powermaxed

POWERMAXED - Shampoo Concentrate with Ultra Wax - 1L

Parte: STLCSUWRTU

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£5.09

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

POWERMAXED - Shampoo Concentrate with Ultra Wax - 1L

Power Maxed Shampoo & Ultra Wax

Power Maxed Shampoo & Ultra Wax is a vehicle shampoo for removing stubborn contaminants which aren’t already removed by a touchless wash. This is the bit where you get hands-on, caressing your vehicle with the best value shampoo and wax, meaning you can thoroughly clean and wax your car too, with minimal effort.

Perfect for:

·         Getting ‘hands-on’ and cleaning your car

·         HGV shampoo

·         Van shampoo

·         Car shampoo

·         Washing and waxing

·         Getting the best results from your wash


Shampoo & Ultra Wax contains foam boosters and strong detergents to easily lift dirt away from the surface of the vehicle, meaning minimal scrubbing is required, which means happier paintwork. The foam keeps any lifted contaminants suspended away from the paintwork ready to harmlessly be rinsed away. It also contains Carnauba wax which it leaves behind as a protective residue, leaving your vehicle looking glossy and the paintwork protected against contaminants such as water spots and bug splats. This also aids rinsing. Used at the recommended dilution rate, the vehicle will be finished completely streak-free.

Info

Brand

powermaxed

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!