Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

GYEON

GYEON - Q2M Leather Cleaner Strong - 1000 ml

Part: BRNGLCS1000R

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£19.88

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - Q2M Leather Cleaner Strong - 1000 ml

SUPERB MAINTENANCE PRODUCTS FOR OUTSTANDING DETAILING PERFORMANCE. Q2M LeatherCleaner Strong is an efficient and effective pre-coating leather cleaner. Developed along with Gyeon's high-end Q2 LeatherShield, it is the ultimate leather preparation product for use before a coating application. It removes dirt, oily residue and discolouration. Unlike most leather cleaners, the formula does not include any softening or preserving additives, leaving a surface ready for coating. STRONG CLEAN FOR ANY TYPE OF LEATHER Q2M LeatherCleaner Strong is the ultimate solution for cleaning and preparing leather upholstery for application of a ceramic coating. It does not contain any softening additives and does not leave any residue that could potentially interfere with a quality ceramic coating. Q2M LeatherCleaner leaves a fully matte finish and is suitable for all modern types of leather.

Info

Brand

GYEON

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!