Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

GYEON

GYEON - QM Interior Detailer - 1L

Part: BRNGIND1000R

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£24.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - QM Interior Detailer - 1L

GYEON QM Interior Detailer - 1L, a must-have for those committed to maintaining the immaculate condition of their vehicle interiors with optimal hygiene. This innovative product features a cutting-edge alcohol-based formula composed of 60% alcohol, ensuring a deep, sanitising clean that effectively removes a vast majority of organic contaminants from any surface it touches. Its versatility offers a comprehensive cleaning solution for all interior surfaces, enhancing the cleanliness of your car with ease. While QM Interior Detailer is designed to complement rather than replace the QM Vinyl and Leather Cleaners, it sets a new standard in maintaining vehicle interiors by gently cleansing without compromising material integrity.

With the increased focus on hygiene, maintaining a clean environment has never been more critical. The QM Interior Detailer is specifically engineered to address modern hygiene demands, providing a reliable solution that ensures the health and well-being of you and your loved ones. Its powerful yet gentle formulation allows it to safely clean and disinfect a variety of materials, including leather, vinyl, and plastics, leaving a fresh, clean scent without residue.

Features:

  • Alcohol-Based Formula: Contains 60% alcohol for effective removal of organic contaminants.
  • Versatile Application: Safe for use on all interior surfaces, including leather, plastics, and vinyl.

  • Quick and Efficient: Delivers a thorough clean with minimal effort, ideal for regular maintenance.

  • Complementary Use: Works in harmony with QM Vinyl and Leather Cleaners to provide comprehensive care.

  • Fresh Fragrance: Leaves interiors smelling fresh and clean without leaving a sticky residue.

Invest in the GYEON QM Interior Detailer - 1L to achieve superior cleanliness and hygiene for your vehicle's interior. This essential product ensures your car remains a sanctuary of cleanliness and comfort, providing peace of mind on every journey.

Info

Brand

GYEON

Capacity

1L

Product Type

Interior Detailer

Formula

60% Alcohol Based

Fragrance

Fresh

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!