Truck

Free Delivery - For orders above £25

Kalarna

Klarna - Pay in 30 Days

GYEON - Q2M Bathe Shampoo - 1L

GYEON

GYEON - Q2M Bathe Shampoo - 1L

Part: BRNGBAT1000R

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£21.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - Q2M Bathe Shampoo - 1L

GYEON Q2M Bathe Shampoo 1L

GYEON is a globally renowned brand in the world of premium car care, dedicated to producing high-quality, innovative detailing solutions trusted by professionals and enthusiasts alike. Known for precision engineering and exceptional performance, GYEON products combine advanced chemistry with user-friendly application, ensuring superior results for every vehicle. The brand unwavering commitment to excellence means every formulation is designed to protect, enhance, and maintain your car finish to the highest possible standard.

Key Features:

  • Highly concentrated formula Like other products in our range, Q2M Bathe is superbly efficient thanks to its highly concentrated formula, ensuring maximum cleaning power with minimal product usage.

  • Thick, water-soluble gel The thick gel is naturally water-soluble, making it easy to dilute and rinse away without leaving any residue.

  • Premium scent Emitting a delightful smell reminiscent of Q2M Cure REDEFINED, it makes the car washing experience both effective and enjoyable.

  • Long-lasting foam Produces a dense, long-lasting foam that clings to the paintwork, allowing for a thorough and gentle wash that minimises the risk of swirl marks.

  • Safe for all paint types Formulated to be pH-neutral, ensuring safe use on all surfaces, including ceramic-coated and delicate finishes.

  • Professional results at home Designed to meet professional detailing standards while remaining easy to use for enthusiasts.

Maintaining your vehicle paintwork is essential for both its appearance and long-term protection. GYEON Q2M Bathe Shampoo 1L not only cleans your car to perfection but also ensures that every wash is gentle, effective, and safe for your finish. A must-have in any car care kit, it delivers showroom-worthy results with every use.

Info

Size

1L

Brand

GYEON

Formula

pH Neutral, Concentrated, Water-soluable

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!