Truck

Free Delivery - For orders above £25

Kalarna

Klarna - Pay in 30 Days

Engine Oil

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
castrol

CASTROL - Engine Oil Power 1 Scooter 2T - 1L

Part: CAS1600A1

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£18.80£25.75

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CASTROL - Engine Oil Power 1 Scooter 2T - 1L

The Castrol POWER1 Scooter 2T - 1L Engine Oil exemplifies Castrol's commitment to excellence and innovation in automotive lubricants. Engineered with the groundbreaking Power Sustain Formula™, this oil ensures your scooter's engine remains clean, promoting vigorous performance and longevity. Designed specifically for 2-stroke scooters, it offers unparalleled engine protection and efficiency. With a low-ash formulation, Castrol POWER1 Scooter 2T minimises spark plug fouling, thereby enhancing engine life and reliability, pivotal for demanding city commutes and countryside expeditions alike. Exceeding JASO FD and ISO-L-EGD standards, this engine oil is more than just a lubricant; it’s a vital component of your scooter’s maintenance regimen. It provides exceptional high-temperature detergency, ensuring that engines perform optimally even under the most intense conditions. This attribute, combined with its compatibility with modern catalytic converters, positions Castrol POWER1 Scooter 2T as a leader in the scooter engine oil market. Castrol's extensive distribution ensures the availability of this top-tier product to retail customers, independent garages, and national chains. This broad network reinforces Castrol's reputation as a reliable partner, providing consistent access to high-quality oils that maintain scooters in peak condition. Trust in Castrol's pioneering technology to deliver the highest standards of protection and efficiency, making every ride smooth and worry-free.

Features:

  • Advanced Formula: The Power Sustain Formula™ maintains a clean engine for sustained performance.
  • Reduced Maintenance: Low-ash formulation decreases spark plug fouling, prolonging engine life.
  • High Temperature Performance: Excellent detergency ensures optimal engine function in demanding conditions.
  • Standards Compliance: Surpasses JASO FD and ISO-L-EGD standards for superior protection.
  • Catalytic Converter Compatibility: Supports modern converters, enhancing overall scooter efficiency.
  • Distribution Network: Supported by a vast and reliable network, ensuring product availability.
  • Comprehensive Protection: Designed for 2-stroke scooters, delivering long-lasting reliability.

 

Choosing a high-quality engine oil is crucial for maintaining your vehicle's peak performance and longevity. Premium engine oils provide excellent lubrication, which minimises friction among moving components. This reduction in friction not only prevents wear and tear on the engine but also enhances fuel efficiency, yielding long-term cost savings. High-quality oils possess quality thermal stability and viscosity, ensuring optimal engine performance across a broad range of temperatures and driving conditions. Furthermore, they effectively disperse contaminants and help maintain engine cleanliness, preventing sludge buildup that can impair engine function. By investing in a quality engine oil, you are ensuring the reliability and efficiency of your vehicle, avoiding potential breakdowns, and experiencing a smoother, more responsive drive.

 

 

 

 

Fitment Info

Size

1L

Brand

castrol

Packing Type

Bottle

Specification

ISO ISO-L-EGD

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!