Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

FLEX

FLEX - OSE 2-70x198-EC Compact orbital sander with speed control

Part: BRN530632

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£350.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

FLEX - OSE 2-70x198-EC Compact orbital sander with speed control

Brushless motor with greater efficiency and a longer service life E-signal switch for simple, safe operation with quick-stop function prevents trailing of the backing pad Sanding speed suitable for the material thanks to electronic speed adjustment SHOW LESS Ideal for sanding filled surfaces on car parts during repair work.

For surface sanding the substrate and avoiding unevenness before applying the filler and using a random orbit sander

Electronics: Speed preselection with 4 settings, constant speed control by means of tachogenerator, soft start, restart protection Velcro backing pad with bevelled pad geometry and multi-hole system for optimum suction, suitable for all commercially available pads Lightweight, compact one-handed orbital sander, very ergonomic and low-vibration thanks to special balancing for fatigue-free and joint-friendly work Ergonomically designed, handy grip cover with soft grip insert ensures a secure grip and good guidance.

Effective dust extraction thanks to integrated extractor for dust-free working with filter cartridge External dust extraction Ø 27 mm, antistatic suction hose SH 27x3,5m AS (445.045) can be connected

Info

Brand

FLEX

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!