Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Koch-Chemie

KOCH-CHEMIE - FSE Quick Detailer 1L

Part: MOEK285001

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£11.23

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

KOCH-CHEMIE - FSE Quick Detailer 1L

All-round detailing spray for fast care of all external vehicle surfaces such as paintwork, glass and plastics. With its special formula even stubborn limescale stains are removed quickly and without leaving any residue. Maintains and preserves in a single step. Depth of colour is returned leaving a smooth brilliant high gloss free from streaks. Finish Spray exterior is quickly removed, is easy to use and protects the surfaces against new dirt.

Recommendations for use Use the spray bottle to apply evenly to the areas to be treated and polish off with a Profi microfibre cloth.

Areas of use External surfaces of vehicles (paintwork, glass, plastic)

Info

Brand

Koch-Chemie

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!