Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

Mcrofbre

MCROFBRE - Versatowel Yellow 40pk

Parte: MCR5070002022732

stock status

Disponible - Sólo colección

  • Timeline
    Entrega a Domicilio No Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£28.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

MCROFBRE - Versatowel Yellow 40pk

This Versatowel Edgeless Long/short pile, 400gsm, 40x40cm, high polyamide content cloth is the optimum Microfibre towel for removing residues from delicate, high gloss surfaces such a vehicles paintwork. The extra polyamide content (it has 30% vs as little as 20% for standard cloths) makes the Versatowel edgeless exceptionally efficient at polish and compound residue removal. It has become somewhat of the detailing industry standard microfibre towel for general cleaning applications and the levelling of ceramic coating. This can be bought as a box dealSize: 40cm x 40cmWeight: 400GSMContains: 30% Polyamide 70% Polyester. Top Tip: Can be cut into pieces to Ceramic Coat intricate areas or apply dressings. VERSATOWEL EDGELESS��� - Defining Versatility. Product Features: (Pack of 40) ��� Multi-Purpose Edgeless Microfibre Towel ��� Ultra Durable ��� No Irritating Label to Remove ��� Long and Short Pile ��� Removing Compounds and Coatings

Info

Brand

Mcrofbre

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!