Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Mcrofbre

MCROFBRE - Versatowel Green 40pk

Part: MCR5065020177076

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£27.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

MCROFBRE - Versatowel Green 40pk

This Versatowel Edgeless Long/short pile, 400gsm, 40x40cm, high polyamide content cloth is the optimum Microfibre towel for removing residues from delicate, high gloss surfaces such a vehicles paintwork. The extra polyamide content (it has 30% vs as little as 20% for standard cloths) makes the Versatowel edgeless exceptionally efficient at polish and compound residue removal. It has become somewhat of the detailing industry standard microfibre towel for general cleaning applications and the levelling of ceramic coating. This can be bought as a box dealSize: 40cm x 40cmWeight: 400GSMContains: 30% Polyamide 70% Polyester. Top Tip: Can be cut into pieces to Ceramic Coat intricate areas or apply dressings. VERSATOWEL EDGELESS™ - Defining Versatility. Product Features: (Pack of 40) • Multi-Purpose Edgeless Microfibre Towel • Ultra Durable • No Irritating Label to Remove • Long and Short Pile • Removing Compounds and Coatings

Info

Brand

Mcrofbre

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!