Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

Engine Oil

Tu Vehículo Actual

UK
O
Seleccionar Marca
Seleccionar Modelo
Seleccionar Año
Seleccionar Motor
comma

COMMA - Engine Oil Eco-MB 0W-40- 5L

Parte: COMECOMB5L

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£65.50

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

COMMA - Engine Oil Eco-MB 0W-40- 5L

Comma is a trusted UK-based brand known for delivering high-performance automotive lubricants that meet the exacting standards of modern vehicles. With a strong reputation among professional mechanics and car enthusiasts alike, Comma combines advanced formulation technologies with eco-conscious innovation to ensure reliable engine protection, fuel efficiency, and environmental sustainability.

Key Features of Comma Eco Engine Oil:

  • Fuel-efficient formula designed to reduce internal engine friction, improving fuel economy and lowering emissions.

  • Advanced engine protection for outstanding wear resistance during cold starts and demanding driving conditions.

  • Low SAPS technology, safe for modern engines with particulate filters and catalytic converters.

  • Extended drain intervals for long-lasting performance and reduced maintenance frequency.

  • Eco-friendly composition that complies with strict environmental standards for a cleaner drive.

Ideal for drivers seeking dependable performance while minimizing environmental impact, Comma Eco Engine Oil helps your engine run smoother, cleaner, and longer.

Fitment Info

Size

5L

Type

Semi Synthetic Oil

ACEA

A3/B3, A4/B4

Brand

comma

Packing Type

Bottle

Specification

ACEA A3/B4, API SN

Oil - manufacturer recommendation 1

MB229.5, MB226.5

Oil - manufacturer recommendation 2

Porsche A40

Oil - manufacturer recommendation 3

VW 502.00, VW 505.00

Oil - manufacturer recommendation 4

Ford M2C937-A

Oil - manufacturer recommendation 5

Renault RN0700, RN07

Grade

0W-40

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!