Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Engine Oil

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
comma

COMMA - Engine Oil Eco-LLP 0W-20 - 5L

Part: COMECOLLP5L

(1)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£78.06

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

COMMA - Engine Oil Eco-LLP 0W-20 - 5L

Comma is a trusted UK-based brand known for delivering high-performance automotive lubricants that meet the exacting standards of modern vehicles. With a strong reputation among professional mechanics and car enthusiasts alike, Comma combines advanced formulation technologies with eco-conscious innovation to ensure reliable engine protection, fuel efficiency, and environmental sustainability.

Key Features of Comma Eco Engine Oil:

  • Fuel-efficient formula designed to reduce internal engine friction, improving fuel economy and lowering emissions.

  • Advanced engine protection for outstanding wear resistance during cold starts and demanding driving conditions.

  • Low SAPS technology, safe for modern engines with particulate filters and catalytic converters.

  • Extended drain intervals for long-lasting performance and reduced maintenance frequency.

  • Eco-friendly composition that complies with strict environmental standards for a cleaner drive.

Ideal for drivers seeking dependable performance while minimizing environmental impact, Comma Eco Engine Oil helps your engine run smoother, cleaner, and longer.

Fitment Info

Size

5L

Type

Semi Synthetic Oil

ACEA

C5

Brand

comma

Packing Type

Bottle

Specification

ACEA C5

Oil - manufacturer recommendation 1

VW 508.00, VW 509.00

Oil - manufacturer recommendation 2

Porsche C20

Grade

0W-20

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!