Truck

Free Delivery - For orders above £25

Kalarna

Klarna - Pay in 30 Days

CATACLEAN - Diesel Exhaust and System Cleaner

CATACLEAN

CATACLEAN - Diesel Exhaust and System Cleaner

Part: CAT002

(15)
Guarantee Badge Icon

Money Back Guarantee

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£16.60£18.49

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CATACLEAN - Diesel Exhaust and System Cleaner

Experience advanced diesel engine care with Cataclean Diesel Particulate Filter Cleaner, a premium solution engineered to enhance engine efficiency and longevity. Renowned for its high-quality formulation, Cataclean supports optimum vehicle performance by addressing critical exhaust and injection system components.

Innovatively designed to integrate seamlessly with modern diesel engines, delivering measurable improvements in fuel use and emissions.

Features:

  • Fuel Economy Improvement: Enhances mileage and reduces fuel costs
  • Emission Reduction: Significantly lowers harmful exhaust outputs
  • Performance Restoration: Revives engine responsiveness and power
  • DPF Protection: Minimises risk of filter blockages
  • Exhaust System Care: Maintains catalytic converter and related parts

 

 

Reliability and precision engineering ensure consistent results that preserve the health of critical diesel engine components. Trust in a solution that supports sustainable driving and extends vehicle life through meticulous maintenance.

Catalan offer a ‘MoneyBack Guarantee’ if your vehicle fails its’ MOT due to emissions, simply head to https://cataclean.com/motterms/ to find out how to claim!

Info

Brand

CATACLEAN

Warranty

Money Back Guarantee

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!