Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

POWATEC

POWATEC - Fuel Treatment

Part: PWTPWT1101

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£6.69£8.89

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

POWATEC - Fuel Treatment

The Complete Petrol System Cleaner (PWT1101) is a professional‑grade fuel system cleaner designed for all petrol‑powered engines, including FSI, direct injection and turbocharged engines. It thoroughly cleans the entire fuel system to ensure perfect fuel nebulisation at injectors and valves, helping to maintain powerful combustion, strong performance and low fuel consumption. Recommended for use during regular servicing and fully compatible with catalytic converters and turbo systems.

Features:

  • Complete Fuel System Cleaning: Cleans injectors, valves and the entire petrol fuel system for optimal fuel nebulisation.
  • Wide Engine Compatibility: Suitable for all petrol engines including FSI, direct injection and turbocharged applications.
  • Improves Combustion & Performance: Ensures clean, powerful combustion for improved engine response and efficiency.
  • Reduces Fuel Consumption: Supports lower fuel usage through cleaner and more efficient fuel delivery.
  • Professional Use Formula: Designed for workshop use during servicing, binding condensed water in the system for added protection.
 

Info

Brand

POWATEC

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!