Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

POWATEC

POWATEC - Complete Petrol System Car Cleaner Additive Treatment - 375ML

Part: PWTPWT1101

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£6.69£8.89

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

POWATEC - Complete Petrol System Car Cleaner Additive Treatment - 375ML

The Complete Petrol System Cleaner (PWT1101) is a professional‑grade fuel system cleaner designed for all petrol‑powered engines, including FSI, direct injection and turbocharged engines. It thoroughly cleans the entire fuel system to ensure perfect fuel nebulisation at injectors and valves, helping to maintain powerful combustion, strong performance and low fuel consumption. Recommended for use during regular servicing and fully compatible with catalytic converters and turbo systems.

Features:

  • Complete Fuel System Cleaning: Cleans injectors, valves and the entire petrol fuel system for optimal fuel nebulisation.
  • Wide Engine Compatibility: Suitable for all petrol engines including FSI, direct injection and turbocharged applications.
  • Improves Combustion & Performance: Ensures clean, powerful combustion for improved engine response and efficiency.
  • Reduces Fuel Consumption: Supports lower fuel usage through cleaner and more efficient fuel delivery.
  • Professional Use Formula: Designed for workshop use during servicing, binding condensed water in the system for added protection.
 

Info

Brand

POWATEC

Engine Compatibility

FSI, direct injection and turbo engines

Fuel System Application

Complete petrol fuel system

Suitable Components

Injectors, valves, catalytic converter, turbocharger

Cleaning Function

Cleans fuel system and ensures optimal fuel nebulisation

Performance Benefit

Improves combustion, performance and efficiency

Fuel Consumption

Helps reduce fuel consumption

Water Binding

Binds condensed water in the fuel system

Usage Instructions

Add to fuel tank during servicing at manufacturer-recommended intervals

Dosage

375 ml treats up to 80 litres of petrol (approx. 1% of tank volume for larger tanks)

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!