Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

POWATEC

POWATEC - Complete Exhaust System Cleaner - 375ML

Part: PWTPWT1180

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£10.79£13.54

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

POWATEC - Complete Exhaust System Cleaner - 375ML

 

The Complete Exhaust System Cleaner (PWT1180) is a high‑capacity, specially formulated solution designed to thoroughly clean and protect the entire exhaust system. It effectively dissolves dirt, varnish, rubber and carbon deposits, helping to maintain optimal performance of key components including the catalytic converter, turbocharger, EGR valve and lambda probe. Suitable for regular use, it supports efficient engine operation while meeting the latest environmental standards.

Features:

  • Deep Exhaust Cleaning: Dissolves carbon, dirt, varnish and rubber residue throughout the complete exhaust system.
  • Protects Critical Components: Cleans and supports correct operation of the catalytic converter, turbocharger, EGR valve and lambda probe.
  • Improves Performance & Efficiency: Optimises engine performance and helps increase fuel efficiency during regular use.
  • Prevents Heavy Soiling: Reduces the build-up of harmful deposits to maintain long-term exhaust system functionality.
  • Environmentally Compliant: Formulated to meet the latest environmental requirements.

 

 

Info

Brand

POWATEC

Application

Complete exhaust system

Cleaning Function

Dissolves dirt, varnish, rubber and carbon deposits

Suitable Components

Catalytic converter, turbocharger, EGR valve, lambda probe

Performance Benefit

Optimises engine performance

Fuel Efficiency

Helps improve fuel efficiency

Preventive Action

Protects against heavy soiling during regular use

Environmental Compliance

Complies with latest environmental requirements

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!