Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

SIMONIZ

SIMONIZ - Clear Vision Glass Cleaner 500ML

Part: HOLSAPP0181A

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£4.50£5.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SIMONIZ - Clear Vision Glass Cleaner 500ML

Clear Vision Glass Cleaner

Get clear, streak-free windows and mirrors with Simoniz Clear Vision Glass Cleaner. It quickly and effectively cleans all glass, plastics, and mirrored surfaces for better visibility while you’re driving.

Simoniz Clear Vision Glass Cleaner’s rapid action formula cuts through all kinds of grease and road grime, providing maximum clarity and a streak-free finish. It can also be used around the home, quickly removing dust, dirt, and mucky marks to keep your windows and glass surfaces clean and clear.

Specification

  • Rapid grease and grime removal
  • Streak-free finish
  • Use on all glass, plastics, and mirrors
  • Will not damage rubber or silicone seals
  • Effective cleaning of grease, oily residue, fingerprints, smoke haze, and pet slobber
  • Suitable for use in your home, office, vehicle, and caravan or on any glass or mirrored surface

Info

Brand

SIMONIZ

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!