Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

GYEON

GYEON - 5PC Detailing Kit

Part: BRNGYEON01

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£56.49

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - 5PC Detailing Kit

Gyeon Detailing Kit: Complete Care for Your Car

Transform your car's appearance and protect its surfaces with the comprehensive Gyeon Detailing Kit. Designed for car enthusiasts and professionals alike, this kit contains everything you need to achieve a showroom finish and maintain it effortlessly.

What's Inside:

  1. Gyeon Glass 500ml - Glass is the ultimate formula for fast, effortless and effective cleaning of all automotive glass surfaces. Removes oily residue and instantly leaves a smudge free finish.

  2. Gyeon Tire Cleaner 500ml - A specialised and highly effective tyre and rubber cleaner. Removes old dressings and deep, accumulated contamination with ease. Q²M TireCleaner is safe on all types of tyres, including classic white-wall rubber.

  3. Gyeon Bug & Grime 500ml - Bug&Grime is a strong and very efficient pre-wash product developed specially for the removal of insects, bugs and grime.

  4. Gyeon Bathe 500ml - pH neutral shampoo 

  5. Gyeon Interior Detail 500ml - InteriorDetailer has an alcohol-based formula, which removes the majority of organic contaminants from any surface.

With the Gyeon Detailing Kit, you can achieve professional-grade results and keep your car looking its best. Whether you're preparing for a car show or simply want to enjoy a spotless ride, this kit has you covered.

Info

Brand

GYEON

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!