Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

GYEON

GYEON - GYEON Q²M LeatherSet Natural - 200 ml

Part: BRNGLSN200R

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£30.26

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - GYEON Q²M LeatherSet Natural - 200 ml

Complete leather maintenace set Q²M LeatherSet Natural is the complete solution for your leather maintenance. Combining Q²M LeatherCleaner Natural, a safe yet powerful pre-coating cleaner and Q² LeatherCoat Redefined, it becomes the ideal leather maintenance & protection solution. BOX CONTAINS: Q²M LeatherCleaner Natural 200ml / Q² LeatherCoat Redefined 120ml / Q²M ScrubPad EVO / Q²M MF Applicator / Microfibre ALL IN ONE BOX This full set comes with the brand new Q²M ScrubPad EVO & Q²M MF Applicator as well as a microfibre towel. The new Q²M LeatherCleaner Natural foam dispenser allows more effective and easier application out of the box. Q²M LeatherCleaner Natural ensures the removal of light dirt, oily residue and provides best preparation for coating. Q²M LeatherCoat Redefined ensures a long-lasting protective effect and makes future maintenance easier. Gentle and effective Q²M LeatherCleaner Natural is the perfect solution for daily maintenance and pre-coating preparation of leather upholstery. It does not contain any softening additives and does not leave any residue that could potentially interfere with a quality coating. Q²M LeatherCleaner Natural leaves a fully matte finish and is suitable for all modern types of leather. It might also be used on coated leather, not removing the coating and gently cleansing the surface. Best practice and pro-tips from Yves Heylen Don’t be afraid to use water along with the Q²M LeatherCleaner Natural foam. This will help you distribute the product and create more foam. The attached Q²M ScrubPad will agitate the cleaner and remove dirt from the material’s structure. TIP: Always use multiple microfibre towels. It’s worth wiping the leather with a damp towel after cleaning. Consumption: 1set / 2-3 cars

Info

Brand

GYEON

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!