Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

GYEON

GYEON - GYEON Q²M Glass - 1000 ml

Part: BRNGGLA1000R

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£16.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - GYEON Q²M Glass - 1000 ml

Superb maintenance products for outstanding detailing performance. Q²M Glass is the ultimate formula for fast, effortless and effective cleaning of all automotive glass surfaces. Removes oily residue and instantly leaves a smudge free finish. Easy to use and safe for all interior materials like leather, vinyl or alcantara. SAFE AND EFFECTIVE Q²M Glass is safe and effective. Removes dirt, oily residue and even light contamination while not affecting previously applied rain repellents. A gentle aroma boosts the superb qualities of the product. Best practice and pro-tips from Yves Heylen Spray Q²M Glass on a short hair microfibre towel rather than directly on glass. It may be used on plexi or polycarbonate elements as well as on LCD screens or monitors. Consumption: 40ml/car

Info

Brand

GYEON

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!