Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

ADBL

ADBL - Puffy Towel - High-Quality Fluffy Microfibre Towel

Part: BRNADB000230

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£7.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

ADBL - Puffy Towel - High-Quality Fluffy Microfibre Towel

An incredibly fluffy microfibre with long chunky fibres. Ideal for rubbing in all kinds of wax on the most delicate of paints. The ADBL Puffy Towel is an incredibly fluffy microfiber cloth with long, thick fibers, making it ideal for buffing out wax from delicate paintwork. The special fiber structure ensures that the cloth performs excellently both outdoors and indoors. It's also perfect for removing polish residue between polishing sessions, ensuring streak-free results every time. Thanks to its high absorbency and soft texture, the ADBL Puffy Towel leaves no scratches and ensures particularly gentle and thorough cleaning and care. Specifications: A€¢ Size: 41 x 41 cm A€¢ Grammage/Fabric weight: 840 GSM A€¢ Textile content: 70% Polyester / 30% Polyamide Tip: To ensure the longevity of your microfiber products, we recommend the following precautions: Low washing temperature (max. 40A°C), special microfiber detergent, never use fabric softener, and do not tumble dry!

Info

Brand

ADBL

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!