Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Solo

SOLO - Pressure sprayer 333 FA Foamer, 4.0 L, with foot (PH RANGE 1-7)

Part: BRN33331

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£63.00£70.00

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SOLO - Pressure sprayer 333 FA Foamer, 4.0 L, with foot (PH RANGE 1-7)

The 333 FA foam sprayer from the CLEANLine series is equipped with the adjustable varioFOAM foam nozzle patented by SOLO. By turning the adjustment wheel, the moisture level of the foam can be individually adjusted even while working. This allows drier, stable or moister, gel-like foam levels to be set. By optimally adjusting the foam level, the exposure time and thus the cleaning result during spraying can be improved. The FKM seal of the foam sprayer is suitable for the application of acidic, foamable cleaning agents in the pH range 1-7. The light and very robust container is UV-resistant, holds 4 liters and is equipped with a solid base. Thanks to the large opening and the clearly visible scale, precise and easy filling is possible. The large pump allows the maximum pressure of 3 bar to be built up quickly to enable excellent foaming and longer working intervals. The excess pressure in the container can be released via a safety valve for emptying, refilling or cleaning. Pressure over 3 bar is automatically released via this valve. Together with the appropriate foam cleaning agent, the foam sprayer is particularly suitable for Sanitary area, bathrooms Food processing companies Agricultural holdings Stainless steel machines and fittings Rim cleaning. For the removal of limescale residue and water stains, urine scale, rust film, etc. Also ideal for foam cleaning of sensitive surfaces such as carpets and textile surfaces. Suitable for medium and large areas.

Info

Brand

Solo

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!