UPTO 25% OFF SITEWIDE

Usar Código: SALE25

La Oferta Expira en:

00

MM

00

SS

Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

SOFT99

SOFT99 - Fabric Seat Spot Stain Remover 20ml with x1 HPVA Sponge

Parte: BRN02181

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£14.81

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SOFT99 - Fabric Seat Spot Stain Remover 20ml with x1 HPVA Sponge

SOFT99 – Fabric Seat Spot Stain Remover 20ml with x1 HPVA Sponge

SOFT99 is a world-leading Japanese brand renowned for producing innovative, high-performance automotive care solutions. With decades of expertise in detailing technology, SOFT99 combines precision engineering with user-friendly design to create products that deliver exceptional results. From paint protection to interior care, every formula is developed to meet the needs of both professional detailers and everyday car owners who demand the best.

 

Key Features:

  • Targeted stain removal – Special task force! If your fabric upholstery has persistent stains that do not want to give up, it's time for Fabric Spot Remover.

  • Powerful cleaning formula – Its unique formula dissolves almost every type of unwanted residue fixed in fibres, ensuring deep, effective cleaning.

  • Ultra-absorbent sponge included – An ultra-absorbent HPVA sponge included in retail packaging effectively absorbs dirt, leaving the surface completely clean.

  • Safe for fabrics – Fabric Spot Remover is safe, doesn’t cause discolouration or damage, making it suitable for use on car seats, carpets, and other interior fabrics.

  • Convenient, ready-to-use size – The 20ml bottle is perfect for quick fixes, targeted spot cleaning, and keeping in your glove compartment for emergencies.

  • Ideal for stubborn marks – Works on coffee spills, food stains, grease, ink, and other hard-to-remove residues.

 

Cleanliness and presentation are key to maintaining the value and comfort of your vehicle’s interior. SOFT99 Fabric Seat Spot Stain Remover with HPVA Sponge offers a compact yet powerful solution for tackling stubborn marks quickly and safely. Whether used at home or on the go, it ensures your fabric upholstery always looks and feels fresh.

Info

Brand

SOFT99

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!