Truck

Free Delivery - For orders above £25

Kalarna

Klarna - Pay in 30 Days

BODYGUARDS - Finite Orange Grip Nitrile Gloves - Extra Large

BODYGUARDS

BODYGUARDS - Finite Orange Grip Nitrile Gloves - Extra Large

Part: BODGL2015

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£8.74£13.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BODYGUARDS - Finite Orange Grip Nitrile Gloves - Extra Large

For environments where product protection is critical, these gloves are powder-free, minimising particulate contamination. This feature is especially vital in sectors like electronics and food processing, where cleanliness and precision are paramount. Additionally, the absence of latex proteins eliminates the risk of protein sensitisation, making these gloves ideal for individuals with sensitive skin or latex allergies.

Features:

  • Versatile Usage: Suitable as both a heavy-duty disposable or a reusable glove.
  • Enhanced Grip: Diamond texture ensures superior handling and prevents slips.
  • Exceptional Strength: Nitrile formulation resists tears and punctures.
  • Powder-Free Design: Reduces contamination risk in critical environments.
  • Skin-Friendly: Latex-free to prevent allergic reactions.
  • High Visibility: Bold orange colour enhances safety on the job.
  • Tailored Fit: Features an extra large size.

 

The gloves are available in a vibrant orange, a colour choice that enhances visibility and safety in busy work environments. Their measurements ensure a snug and comfortable fit, with fingertips at 0.3 mm and palms at 0.26 mm thickness, offering a fine balance between protection and tactile sensitivity. This design ensures users can perform detailed tasks without sacrificing protection.

Info

Brand

BODYGUARDS

Quantity

90 gloves per box

Size

Extra large

Fingertip thickness

0.3mm

Palm thicknesss

0.26mm

Colour

Orange

Powder Free

Minimises particulate contamination where product protection is of paramount importance

Sensitive skin

No Latex proteins - eliminates protein sensitisation

Versatile

Thicker than a standard disposable, it offers the choice of use as a heavy duty disposable glove or a lightweight re-usable glove

Grip Pattern

Features a diamond grip pattern over the entire glove which optimises surface performance and ensures an exceptional grip

Strength

Superior strength nitrile formulation provides exceptional resistance to tears and punctures even in the toughest environments

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!