Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

SEALEY

SEALEY - Baridi Freestanding Dishwasher, Full Size, Standard 60cm Wide with 14 Place Settings, 8 Programs & 5 Functions, LED Display, Silver

Parte: SEADH167

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£317.98

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SEALEY - Baridi Freestanding Dishwasher, Full Size, Standard 60cm Wide with 14 Place Settings, 8 Programs & 5 Functions, LED Display, Silver

This product is not held in our Warehouse. For dispatch, please allow a minimum of 2 working days.

60cm Freestanding Dishwasher - Fits effortlessly into a standard cupboard space and easily fits pots and pans as well as plates up to 26cm in diameter, you'll never need to wash another dish by hand. Features include a Fast Wash which will leave your dishes sparkling in 60 minutes and Intensive which will remove even the toughest food residue and grease. Adjust the program with Express mode or Power Wash depending on how dirty your dishes are, or specify only one of the two nozzles to be active for more delicate items. Features a child lock system to prevent the door from being accidentally opened mid-wash as well as a pause function so that the door can be safely opened before the cycle finishes. Easily fit this dishwasher into your kitchen, simply remove the top to fit beneath your countertop and use the adjustable levelling feet to balance the unit.

Warranty: 1 year

Info

Brand

SEALEY

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!