Truck

Free Delivery - For orders above £25

Kalarna

Klarna - Pay in 30 Days

DRIVETEC - Aerosol Brake Cleaner

DRIVETEC

DRIVETEC - Aerosol Brake Cleaner

Part: DRCBC500ML

(42)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£2.95£4.19

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

DRIVETEC - Aerosol Brake Cleaner

Experience superior cleaning performance with DRIVETEC's Aerosol Brake Cleaner 500ml, engineered for precision and fast-acting efficiency. Trusted by professionals, this formula delivers a spotless finish, ensuring optimal brake system functionality and enhanced safety on every journey.

Advanced solvent technology removes grease and brake dust without residue, compatible with a wide range of brake components.

Features:

  • Fast Evaporation: Leaves no oily residue
  • Powerful Cleaning: Dissolves grease instantly
  • Non-Corrosive: Safe for all brake parts
  • Easy Application: Convenient aerosol spray


Reliability and high performance underpin every aspect of this formula, delivering consistent results that maintain brake efficiency and extend component life. Precision in cleaning supports safer driving experiences and peace of mind for vehicle owners.

Info

Brand

DRIVETEC

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!