Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

Engine Oil

Tu Vehículo Actual

UK
O
Seleccionar Marca
Seleccionar Modelo
Seleccionar Año
Seleccionar Motor
VETECH

VETECH - Engine Oil SSL Multi 5W-30 - 20L

Parte: VETLNV55

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£82.21£108.17

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

VETECH - Engine Oil SSL Multi 5W-30 - 20L

Vetech is a respected name in automotive lubrication, supplying high-quality multi-fleet oils to thousands of garages across the UK. Known for reliability and zero reported technical issues, Vetech oils are engineered to meet the demands of modern engines—whether you're driving a compact city car or a light commercial vehicle. With formulations that meet or exceed OEM standards, Vetech ensures your engine runs cleaner, smoother, and longer.

 

Key Features:

  • Fully Synthetic & Semi-Synthetic Options: Designed for both standard and extended service intervals, offering flexibility for all vehicle types.

  • Low SAPS Technology: Protects diesel particulate filters (DPFs) and catalytic converters, extending the life of exhaust systems.

  • Wide Manufacturer Approvals: Meets specifications from VW, BMW, Mercedes-Benz, Ford, GM, and more.

  • Enhanced Fuel Economy: Optimised frictional properties help reduce fuel consumption and emissions.

  • Cold Start Protection: Excellent low-temperature fluidity ensures rapid oil circulation and reduced wear during startup.

 

Vetech oils are essential for maintaining engine health and efficiency in today’s high-performance vehicles. Whether you're servicing a fleet or your personal car, Vetech delivers dependable protection with every drop.

Fitment Info

Size

20L

Brand

VETECH

Grade

5W-30

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!