Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Engine Oil

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
VETECH

VETECH - Engine Oil FMC 5W-20 - 20L

Part: VETVT52020FMC

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£131.29

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

VETECH - Engine Oil FMC 5W-20 - 20L

Vetech is a respected name in automotive lubrication, supplying high-quality multi-fleet oils to thousands of garages across the UK. Known for reliability and zero reported technical issues, Vetech oils are engineered to meet the demands of modern engines—whether you're driving a compact city car or a light commercial vehicle. With formulations that meet or exceed OEM standards, Vetech ensures your engine runs cleaner, smoother, and longer.

 

Key Features:

  • Fully Synthetic & Semi-Synthetic Options: Designed for both standard and extended service intervals, offering flexibility for all vehicle types.

  • Low SAPS Technology: Protects diesel particulate filters (DPFs) and catalytic converters, extending the life of exhaust systems.

  • Wide Manufacturer Approvals: Meets specifications from VW, BMW, Mercedes-Benz, Ford, GM, and more.

  • Enhanced Fuel Economy: Optimised frictional properties help reduce fuel consumption and emissions.

  • Cold Start Protection: Excellent low-temperature fluidity ensures rapid oil circulation and reduced wear during startup.

 

Vetech oils are essential for maintaining engine health and efficiency in today’s high-performance vehicles. Whether you're servicing a fleet or your personal car, Vetech delivers dependable protection with every drop.

Fitment Info

Size

20L

Type

Fully Synthetic Oil

Brand

VETECH

Packing Type

Bottle

Specification

API SN Plus

Oil - Manufacturer Recommendation

Ford WSS-M2C948-B

Grade

5W-20

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!