Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

INFINITY

INFINITY - 13pcs Maintain & Enhance Kit

Part: BRNICLPH13MH

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£138.88

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

INFINITY - 13pcs Maintain & Enhance Kit

13pcs Maintain & Enhance Kit�� �� �� �� �� ��

The Viral Car Care Products That 1,524+ DIY Detailers Swear By!

Take the step into professional detailing the easy way! Our 13 piece car detailing box has everything you need to succeed at home.

Whats in the box?��

Incinerate wheel cleaner 500ml concentrate
Citrus pre-wash 500ml concentrate
Wipeout snowfoam 500ml concentrate��
Insect strip 500ml
Pure shampoo 500ml concentrate
Liquid fire 500ml��
Liquefy tar & glue remover 500ml
Spotless glass cleaner 500ml
Interior detailer 500ml��
Express sealant 500ml��
Rapid detailer 500ml��
Tyre gel 500ml��
Air freshener 250ml

Product details and step by step process:��

Incinerate Wheel Cleaner (non acid) - This powerful alkaline cleaner tears through even the toughest grime on both wheels and tyres. Trusted by over 15k UK detailers, this wheel cleaner will leave you speechless! It can be used right from the bottle, but can also be diluted up to 25x for amazing value.��

Citrus Pre-wash (non caustic) - We all know to avoid caustic pre-washes right? And the irreversible damage they can cause is no joke. Luckily there is an alternative, Citrus! Made using orange oil rather than harsh chemicals it will remove 95% of visible dirt from your vehicle BEFORE the need to touch it. Making your wash regime as safe and effective as possible. It can also be diluted up to 25x making it a no brainer for keeping your vehicle maintained.��

Wipeout Snowfoam (PH Neutral) - Blanketing your vehicle in a rich creamy foam that gets into all the hidden areas, Wipeout gently emulsifies with remaining dirt and grime to ensure the safest possible pre-wash. Its concentrated and can be diluted 10x for maximum bang for your buck! It also looks good for those instagram shots.��

Insect Strip (instant action) - Stubborn insect deposits can be hard to remove, not anymore! Insect Strip literally melts the organic matter of the insect in under a minute, creating an orange sludge that can be simply rinsed away without scrubbing.

Pure Shampoo (wax free) - When it comes to shampoo what you really need is a highly concentrated product that provides excellent lubrication. This avoids scratching and marring. Pure shampoo can be diluted an incredible 2000x and in addition has no additives like waxes or gloss enhancers that can mask or clog up more powerful protection.��

Liquid Fire (fallout remover) - As the name suggests, this stuff packs a real punch! Designed to dissolve embedded ferrous metal particles from wheels and paintwork that can leave the surfaces feeling rough and contaminated. Simply spray on, watch the magic reaction happen before rinsing away!

Liquefy Tar Remover (instant action) - Annoying tar spots can be a nightmare to remove. Not anymore. Liquefy begins to melt them on contact to leave a refreshed paintwork surface.��

Spotless Glass Cleaner (cannot streak) - Yes you read that right, spotless glass cleaner is potent enough to remove stubborn grime, including vape residue, and its advanced formula makes it literally impossible to streak. It feels almost like it melts into the glass! Gone are the days of chasing glass streaks for that perfect finish.��

Interior Detailer (anti-static) - This is a really versatile product, on the one hand you can easily remove general day to day grime from the interior surfaces. However it also leaves an anti-static coating behind, particularly good on dashboards where dust can gather and infotainment screens where it resists finger marks. This coating is tactile and makes the interior feel ""as new"" to the touch. It also leaves no dressing behind, just a fresh look, feel and irresistible smell. Its suitable for plastic, vinyl, leather, alcantara, tft/ lcd screens, glass touch screens.��

Express Sealant (wet coat Si02) - Looking for amazing beading on your paint? Also feeling a but lazy? Express is the answer! Simply spray directly on the vehicle when its clean and still wet, then gently rinse off and dry. The results you will get are quite simply jaw dropping. Top tier water behaviour and a noticeable slickness to the paint. It can also be used on wheels to instantly seal them and also prevents rust developing on brake discs!

Rapid Detailer (No buffing) - One of our most popular products. Rapid Detailer gives your paint a just waxed look for almost none of the associated effort! Simply spray, wipe and walk away. No buffing is required to achieve an amazing deep gloss and excellent water repellency. It can even be used to protect your glass without streaking. Use either this or Express, using both on the same wash is overkill and wont give better results, however you can use Express on one wash, then Rapid Detailer on the next.

Tyre Gel (high gloss & no sling) - The finishing touch is always the tyres, and Tyre Gel doesn't disappoint. You'll be amazed how little you need to get a great finish, the solvent based dressing looks quite thin when its inside the bottle, but that's part of the illusion. Once it contacts with rubber watch it turn to a sticky gel that clings and refuses to let go! 2 week durability is normal and the fragrance of strawberry really sets it off as a great product in both user experience and performance.��

Air freshener Aventus, ��250ml spray can last over 360 sprays!

��

Info

Brand

INFINITY

Contains:

Incinerate wheel cleaner 500ml concentrate, Citrus pre-wash 500ml concentrate Wipeout Snowfoam 500ml concentrate, Insect strip 500ml, Pure shampoo 500ml concentrate, Liquid fire 500ml, Liquefy tar & glue remover 500ml, Spotless glass cleaner 500ml, Interior detailer 500ml, Express sealant 500ml, Rapid detailer 500ml, Tyre gel 500ml, Air freshener 250ml

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!