Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Engine Oil

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
VETECH

VETECH - Engine Oil PSA 0W-30 - 20L

Part: VETVT03020PSA

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£116.15

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

VETECH - Engine Oil PSA 0W-30 - 20L

Vetech is a respected name in automotive lubrication, supplying high-quality multi-fleet oils to thousands of garages across the UK. Known for reliability and zero reported technical issues, Vetech oils are engineered to meet the demands of modern engines—whether you're driving a compact city car or a light commercial vehicle. With formulations that meet or exceed OEM standards, Vetech ensures your engine runs cleaner, smoother, and longer.

 

Key Features:

  • Fully Synthetic & Semi-Synthetic Options: Designed for both standard and extended service intervals, offering flexibility for all vehicle types.

  • Low SAPS Technology: Protects diesel particulate filters (DPFs) and catalytic converters, extending the life of exhaust systems.

  • Wide Manufacturer Approvals: Meets specifications from VW, BMW, Mercedes-Benz, Ford, GM, and more.

  • Enhanced Fuel Economy: Optimised frictional properties help reduce fuel consumption and emissions.

  • Cold Start Protection: Excellent low-temperature fluidity ensures rapid oil circulation and reduced wear during startup.

 

Vetech oils are essential for maintaining engine health and efficiency in today’s high-performance vehicles. Whether you're servicing a fleet or your personal car, Vetech delivers dependable protection with every drop.

Fitment Info

Size

20L

Type

Synthetic Oil

ACEA

C2

Brand

VETECH

Packing Type

Bottle

Specification

ACEA C2, API SN

Oil - Manufacturer Recommendation

Peugeot/Citroen B71 2312

Grade

0W-30

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!