Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

milwaukee

MILWAUKEE - M12™ - M18™ Multi Fast Charger

Part: GEQ4932451080

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£67.79

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

MILWAUKEE - M12™ - M18™ Multi Fast Charger

Dual charger that will charge both M18™ and M12™ batteries

Recharges in sequence - first in, first to charge - resulting in less time needed to manage charging cycles

Info

Brand

milwaukee

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!