Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Oil Filter

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
FEBI

FEBI - Urea Filter

Part: FEB45595

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£12.64£16.63

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

FEBI - Urea Filter

The FEBI - AdBlue Urea Filter is a crucial component in modern diesel emission control systems, specifically designed to maintain the purity of AdBlue® fluid before it enters the SCR (Selective Catalytic Reduction) system.

Features:

  • Essential for SCR systems: Filters urea-based DEF before it reaches the injector and dosing module.
  • Protects sensitive components: Prevents blockages and crystallisation that can damage AdBlue® injectors.
  • Chemically resistant materials: Designed to withstand corrosive AdBlue® fluid and temperature fluctuations.
  • Improves emissions efficiency: Helps maintain compliance with Euro 6 and MOT emission standards.
  • Reduces maintenance costs: Minimises risk of injector failure and system downtime.
  • Direct-fit compatibility: Easy to install across a wide range of diesel vehicles using AdBlue® systems.
  • Supports fuel efficiency: Ensures optimal dosing and NOx reduction for cleaner engine operation.

 

The FEBI - AdBlue® Urea Filter is a cost-effective preventative maintenance solution that extends the life of the entire SCR system. By reducing the risk of injector damage and system contamination, it saves drivers and fleet managers from expensive repairs and unplanned downtime.

Fitment Info

Brand

FEBI

Extra Info

These products are designed to be used as originally intended and not modified for purpose. Please ensure the products are installed by a competent individual. N.B. products are usually supplied without fitting instructions.

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!