Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

SIMONIZ

SIMONIZ - Upholstery & Carpet Cleaner 400ML

Part: HOLSAPP0183A

(1)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£5.95

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SIMONIZ - Upholstery & Carpet Cleaner 400ML

Simoniz Upholstery and Carpet Cleaner

Simoniz Upholstery & Carpet Cleaner is a car fabric and carpet cleaner that powers through dirt, stains, and bad odours to leave your interior looking and smelling great.

Thanks to its powerful cleaning formula and handy brush-head applicator, it���s never been easier to clean and maintain your car���s carpets and upholstery.

Simoniz Upholstery & Carpet Cleaner works fast to scrub away even tough and dried-in dirt from car carpets and seats.

The durable brush head works the powerful cleaning foam deep into fibres to remove stains quickly and leave fabrics looking as good as new. It also removes bad odours to leave your car smelling fresh and clean.

Specification

  • Intensive deep cleaning quickly penetrates surfaces to remove ingrained dirt
  • Fast removal of stains and unpleasant odours
  • Use on all carpets and upholstery
  • Dries quickly without leaving any sticky residue
  • Removes odour and leaves a fresh, clean fragrance 

Info

Brand

SIMONIZ

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!