Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

BigBoi

BIGBOI - Pre-Wash Foam

Part: ULFFOAMR

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£19.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BIGBOI - Pre-Wash Foam

Thick. Clingy. Contaminant-Crushing – The Safest First Touch

BigBio FoamR Pre-Wash Foam your paint’s first line of defense. This high-density pre-wash clings vertically to dissolve bug guts, bird bombs, and road film before your mitt even touches the paint. Formulated for ceramic-coated and bare finishes, its tropical-scented bubbles lift grime without stripping wax or sealants, slashing swirl risk by 70%. Pair it with DESCALR shampoo for a 1-2 punch against bonded contaminants.

Why Choose FOAMR?

✔ Bugs cemented on? 5-minute dwell melts them away.
✔ Ceramic coating to protect? pH-balanced and coating-safe.
✔ Hate weak foam? Shaving-cream thickness clings to vertical panels.
✔ Pre-wash newbie? Tropical sorbet scent makes it idiot-proof.

Features

  • High-Adhesion Foam: Stays put for 5+ minutes
  • Organic-Targeting: Enzymes break down protein-based stains
  • Pressure-Washer Optimized: 1:9 ratio for cannon or bucket
  • Eco-Conscious: Biodegradable and waterway-safe

Specifications

  • Size: 500ml (16.9 fl oz) – 10–12 full-car pre-washes
  • Fragrance: Tropical sorbet (no chemical headache)
  • pH Level: 8.5 (gentle yet effective)
  • Origin: Australian-made

How To Use

  • Rinse: Blast loose dirt with WASHR nozzle
  • Mix: 100ml FOAMR + 900ml water in foam cannon
  • Foam: Spray bottom-to-top (dirtiest areas first)
  • Dwell: Let work 3–5 minutes (no drying)
  • Rinse: Pressure wash away before contact wash

Info

Brand

BigBoi

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!