Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

WD40

WD40 - Specialist Fast Acting Degreaser with Smart Straw - 500ML

Part: WDF44393

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£11.32

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

WD40 - Specialist Fast Acting Degreaser with Smart Straw - 500ML

This degreaser is crafted to tackle tough grease, oil, dirt, and grime, ensuring machinery and components run smoother and last longer. Designed with the user in mind, it leaves no residue, ensuring equipment remains clean without the risk of additional build-up or damage. The innovative Smart Straw directs the degreasing agent precisely where needed, enhancing efficiency and reducing waste. Ideal for use on engines, hand and power tools, work surfaces, exhaust hoods, flooring, and industrial machinery, this product offers versatility and reliability in demanding applications. By incorporating the renowned WD-40 formula, it ensures components are protected against wear and tear, reducing maintenance and operational costs.


Features:

  • Immediate Action: Begins working upon contact, significantly reducing cleaning time.
  • No Residue: Leaves surfaces clean without a film, preventing potential re-soiling.
  • Versatile Applications: Effective on various materials including metal, tools, and machinery.
  • Precision Application: Smart Straw technology allows for targeted spraying in hard-to-reach areas.
  • Enhanced Efficiency: Improves equipment performance, contributing to longer operational life.

 

Using a quality fast-acting degreaser is essential for maintaining the optimal performance and longevity of mechanical components, particularly in demanding environments such as automotive workshops and industrial settings. These degreasers, like the WD-40 Specialist Fast Acting Degreaser, are designed to efficiently remove stubborn grease, oil, and grime from various surfaces, ensuring machinery and equipment operate smoothly. The fast-acting nature of these products means they start working instantly upon contact, significantly reducing downtime and enhancing productivity. Moreover, high-quality degreasers leave no residue, preventing potential re-soiling and ensuring components remain clean and ready for use.

Info

Brand

WD40

Type

Degreaser

Capacity

500ML

Features

Cleans oil, grease, dirt and grime

Immediate use

Works immediately on contact

Convenience

Easy to rinse and leaves no residue

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!