Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

SEALEY

SEALEY - Space Warmer® Propane Heater 102,000-170,000Btu/hr (30-50kW)

Part: SEALP170

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£215.94

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

SEALEY - Space Warmer® Propane Heater 102,000-170,000Btu/hr (30-50kW)

This product is not held in our Warehouse. For dispatch, please allow a minimum of 2 working days.

102,000-170,000Btu/hr (30-50kW) variable output Propane Space Warmer®. Features safety solenoid value which prevents the unit from leaking gas and safely ignites by the Piezo push-button ignition system. Supplied with a fully approved gas regulator and hose. The Space Warmer® is fan assisted and as the fuel is completely burned it leaves no oily residue like you may experience when using other types of fuel heaters. There is no odour, except for the few seconds during start-up and the unit runs a little more quietly since they do not need a compressor to drive the fuel to the burner. Heats an area of 23,000ft³(650m³) with a fuel consumption of 2.18-3.63kg/hr.

Warranty: 1 year

Info

Brand

SEALEY

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!