Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

VETECH

VETECH - Screen Wash

Part: GSF981AA1941

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£3.97

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

VETECH - Screen Wash

The VETECH SCREENWASH boasts a formulation that combines gentle care with robust cleaning power. It tackles road grime, insect splatter, and debris effectively, keeping your driving vision crystal clear without harming the delicate surfaces of your vehicle's wiper blades or windscreen. This balance ensures that the material integrity remains intact, meaning longer-lasting wipers and a pristine windscreen. With its versatile all-season formula, VETECH SCREENWASH excels in performance no matter the external temperature. From the bitter chills of winter, where it effortlessly removes road salt and ice, to the scorching heat of summer, eliminating splatters and environmental residue—this screenwash remains your reliable partner in maintaining visibility. The excellence of VETECH’s formula makes it an indispensable component of your car care regimen, ensuring you’re always prepared for the road ahead.

Features:

  • Unmatched Clarity: Provides an unequaled, streak-free finish, ensuring superior visibility and safety by keeping your line of sight pristine at all times.
  • Safe Composition: Thoughtfully crafted to preserve the condition of your vehicle's wiper blades and windscreen materials, prolonging the lifespan of these components.
  • All-Season Performance: This versatile formula ensures effective cleaning across a spectrum of temperatures, making it a staple for year-round use.
  • Easy Application: Designed for straightforward integration into any vehicle's cleaning system, allowing for effortless maintenance.
  • Environmentally Conscious: Produced with eco-friendly practices, this product reduces environmental impact while delivering top-tier performance.
  • Consistent Quality: VETECH prioritizes quality assurance, ensuring that each bottle meets high standards for reliability and effectiveness.

 

Opt for VETECH SCREENWASH to ensure your windscreen remains impeccably clean, enhancing both the aesthetic appeal of your vehicle and the safety of your driving experience. With VETECH, you can rely on a product that marries high performance with environmental mindfulness, providing peace of mind and confidence on every journey with its unwavering quality and commitment to excellence.

Info

Brand

VETECH

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!