Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

castrol

CASTROL - Rust Remover - 300ML 8G

Part: CAS160A23

(1)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£3.83£4.26

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CASTROL - Rust Remover - 300ML 8G

Experience superior protection and maintenance with Castrol Rust Remover 300ml, a trusted solution meticulously engineered to combat corrosion and restore metal surfaces. This expertly formulated product from Castrol exemplifies advanced chemical technology designed to enhance vehicle longevity and maintain optimal performance.

Advanced anti-corrosion formulation for safe use on multiple materials.

Features:

  • Effective Corrosion Control: Prevents rust build-up quickly
  • Material Safe: Suitable for plastics and rubbers
  • Penetrating Formula: Reaches deep into rust-affected areas
  • Resin-Free Composition: Avoids sticky residue


Delivering consistent and reliable protection, this solution ensures components remain in peak condition, reinforcing confidence in every maintenance routine. Its application supports durable, long-lasting care, reflecting quality and precision expected from leading automotive chemistries.

Info

Brand

castrol

Efficient Rust Penetration

Effectively breaks down and loosens rust to restore seized components

Lubrication and Corrosion Protection

Provides lubrication while preventing corrosion to extend metal part lifespan

Material Compatibility

Safe for use on rubber and plastics, protecting sensitive components

Resin, Silicone, and Acid-Free

Gentle formula that protects surfaces without leaving harmful residues

Enhanced Friction Reduction

Minimizes metal-to-metal friction for smoother mechanical operation

Versatile Application

Ideal for vehicles, tools, and a variety of metal surfaces across multiple uses

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!