Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

AUTOBRITE

AUTOBRITE - Purple Velvet Shampoo Concentrated - 500ML

Part: ATBADPVEL500M022

stock status

Collection Only

  • Timeline
    Home Delivery Unavailable
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£9.07

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

AUTOBRITE - Purple Velvet Shampoo Concentrated - 500ML

PURPLE VELVET

Luxurious pH Neutral Purple Velvet shampoo with amazing dilution (up to 1500-1) and fantastic suds! Juicy Fruit fragrance really makes your mouth water when you wash your car!

FEATURES

  • Magical & luxurious shampoo with luxurious suds
  • Leaves a high gloss finish
  • Highly concentrated dilution ratio of 1500 - 1
  • Leaves a lovely slick finish
  • Gorgeous "Juicy Fruit" fragrance
  • PH Neutral formula - safe on all wax surfaces

DESCRIPTION

Our Purple Velvet high gloss car shampoo is rich and luxurious, with amazing dilution creating thick suds that coat your vehicle, grabbing dirt and leaving a velvety sheen behind. With a slick finish every time, this car shampoo is pH neutral and won’t damage any existing wax or LSP layers, and is fantastic for regular car cleaning.

A truly stunning shampoo that does everything you need, just wait until you smell it!

You need to try Purple Velvet HIgh Gloss Shampoo.

HOW TO USE
The goal when washing your vehicle should be to remove as much contamination as possible before carrying out our Safe 2 bucket contact wash, therefore when washing your pride and joy, we thoroughly recommend that you carry out a Pre Wash process using Citrus wash All-purpose cleaner, followed by Magifoam or one of our other pre-wash snow foams.

For the wash process, we recommend using 2 detailing buckets fitted with grit guards to minimize the risk of free-floating debris. Fill both of these buckets with fresh water, one for rinsing and one for your wash solution. Purple Velvet shampoo is an exceptionally high gloss, high foaming shampoo that cleans and maintains as it goes. Containing the finest ingredients to clean all manner of dirt from your paintwork. For general use, Purple Velvets dilution ratio of 1500-1 translates into 10ml or a single cap full per 18-litre bucket. Once you have added your chosen shampoo agitate the solution with a moving water source e.g hose or pressure washer to achieve the level of foam required.

Using a quality wash mitt, begin washing your vehicle from the top, down, applying minimal pressure to your chosen wash media.
Ensure that your wash media is rinsed regularly to prevent particle build-up within the media and reduce the chance of inflicting any paint damage. If washing the vehicle on a warm day we recommend washing panel by panel rinsing as you go. Once the wash is complete, give the vehicle a thorough rinse ensuring to remove any shampoo residue from panel gaps and door shuts.
We recommend using Top Gloss Shine as a drying aid to help reduce the chance of water spotting and leave a glossy finish.

Drying the vehicle should be carried out as soon as possible after washing using one of our Ultimate drying towels Now stand back and admire the gloss.

Info

Brand

AUTOBRITE

Size

500ml

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!