Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

autoglym

AUTOGLYM - Professional Car Shampoo Concentrate - 5L

Parte: AGL14005

stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£24.52

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

AUTOGLYM - Professional Car Shampoo Concentrate - 5L

Autoglym Professional Car Shampoo – 5L
High-Foaming, Easy-Rinsing Shampoo for Effective Traffic Film Removal

Autoglym has long been the go-to brand for professional valeters and detailers across the UK and beyond. Known for delivering dependable, high-performance solutions, Autoglym's Professional range is designed to meet the demands of commercial car care with consistently outstanding results.

The Autoglym Professional Car Shampoo – 5L is a concentrated, high-foaming detergent formulated to break down and remove stubborn traffic film and everyday contaminants from vehicle bodywork. With its neutral pH and pleasant fragrance, it provides a safe and effective clean without compromising surface finishes.

 

 

Key Features:

  • High-foaming formula clings to traffic film and dirt for effective cleaning

  • Easy-rinsing action leaves a clean, residue-free finish

  • Neutral formulation safe for regular use on all automotive paintwork

  • Concentrated for economical dilution and extended use

  • Pleasant fragrance enhances the wash experience

 

Ideal for professional detailers, valeters, and automotive workshops, this 5L shampoo delivers reliable performance and a visibly cleaner finish with every wash.

 

Info

Brand

autoglym

Size

5L

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!