Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

autoglym

AUTOGLYM - Professional Car Shampoo Concentrate - 5L

Part: AGL14005

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£21.32£23.69

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

AUTOGLYM - Professional Car Shampoo Concentrate - 5L

Autoglym Professional Car Shampoo – 5L
High-Foaming, Easy-Rinsing Shampoo for Effective Traffic Film Removal

Autoglym has long been the go-to brand for professional valeters and detailers across the UK and beyond. Known for delivering dependable, high-performance solutions, Autoglym's Professional range is designed to meet the demands of commercial car care with consistently outstanding results.

The Autoglym Professional Car Shampoo – 5L is a concentrated, high-foaming detergent formulated to break down and remove stubborn traffic film and everyday contaminants from vehicle bodywork. With its neutral pH and pleasant fragrance, it provides a safe and effective clean without compromising surface finishes.

 

 

Key Features:

  • High-foaming formula clings to traffic film and dirt for effective cleaning

  • Easy-rinsing action leaves a clean, residue-free finish

  • Neutral formulation safe for regular use on all automotive paintwork

  • Concentrated for economical dilution and extended use

  • Pleasant fragrance enhances the wash experience

 

Ideal for professional detailers, valeters, and automotive workshops, this 5L shampoo delivers reliable performance and a visibly cleaner finish with every wash.

 

Info

Brand

autoglym

Size

5L

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!