Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

FUELTONE

FUELTONE - Pro Diesel System Primer - 3L

Part: FUTFT-DSP-3000

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£61.07

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

FUELTONE - Pro Diesel System Primer - 3L

Pro Diesel System Primer 3L

This product is specifically designed for priming diesel engines. It has exceptionally good ignition properties and has additives designed to reduce stress on exposed metals. It is a premium diesel fuel substitute with specific characteristics designed to assist the priming of Diesel Fuel Systems. 
The product will start your diesel engine first time, every time.                          
A 3L bottle will treat up to 8 filters. Simply fill the fuel filter, fit, and start the engine - EASY AS 1,2,3! 
Struggling to start the engine after replacing the fuel filter? The unique Fueltone formula advances ignition and starts the engine whilst protecting  the fuel pump and starting components. 
 Ideal for workshops / garages with large diesel fleets: delivery vans, taxi’s, bus, coach, truck, marine, agriculture, construction equipment.

- Specially designed for priming diesel systems 

- It is a premium diesel fuel substitute 

- Unique formula that is custom made to deal with the twin issues of prompt ignition at engine start up and ensuring metal components are protected at this vulnerable point 

- Minimises potential damage to engine components during priming 

- Very cost effective way to prime diesel engines  

- Multi dose bottle means it can prime a complete range of fuel filters which makes it more cost effective 

It provides an initial fill of the fuel pump and injectors as part of an engine refit or initial start process.  Users must be familiar with the operation and initial start-up of Diesel engines.  Suitably qualified engineers and fitters only should use this product.  The priming sequence should be as specified by the veichle manufacturer. 

Info

Brand

FUELTONE

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!