Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

NOX Sensor

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
bosch

BOSCH - Nox Sensor

Part: BOS0281008533

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£352.80£470.40

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BOSCH - Nox Sensor

Experience precision and durability with the Bosch Nitrogen Oxide sensor, engineered to deliver accurate exhaust gas measurements and support advanced emission control systems. Renowned for its high-quality manufacturing and rigorous testing, Bosch ensures reliable performance tailored to meet stringent automotive standards.

Utilising cutting-edge electrochemical technology, it enhances system responsiveness and optimises environmental compliance.

Features:

  • High Accuracy: Precise NOx measurement within ±5 ppm
  • Robust Durability: Designed for long operational life beyond 15,000 hours
  • Fast Response: Delivers data in under 60 seconds
  • Wide Compatibility: Suitable for 12V and 24V vehicle systems
  • Advanced Technology: Supports selective catalytic reduction (SCR) for cleaner emissions


Crafted to uphold reliability and efficiency, this solution ensures optimal monitoring and control of exhaust gases, contributing to improved vehicle performance and compliance with environmental regulations. Precision engineering and rigorous quality standards provide confidence in every journey.

Fitment Info

Brand

bosch

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!