Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

CATACLEAN

CATACLEAN - Hybrid Cat Cleaner

Part: MIPCAT008

Guarantee Badge Icon

Money Back Guarantee

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£13.49£17.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

CATACLEAN - Hybrid Cat Cleaner

CATACLEAN - Hybrid Catalytic Cleaner - 500ML, an innovative solution designed to enhance vehicle performance and comply with strict emissions regulations. This advanced catalytic cleaner is expertly formulated to clean and protect your car's catalytic system, substantially reducing harmful emissions while improving fuel efficiency. CATACLEAN's powerful formula is suitable for both petrol and diesel engines, ensuring versatile compatibility and exceptional results across a broad range of vehicles. By effectively breaking down carbon deposits and preventing the formation of new ones, this hybrid cleaner not only helps you pass MOT tests with ease but also extends the life of your vehicle���s catalytic converter.

With its eco-friendly formulation, CATACLEAN helps to maintain optimal engine performance, contributing to a cleaner and more sustainable driving experience. This cleaner can be used quarterly to keep your engine running smoothly and efficiently, ensuring that your vehicle adheres to environmental standards. The 500ML bottle is perfectly sized for convenient application, making it easy to incorporate into your regular vehicle maintenance routine.

��

Features:

  • Fuel Savings: Enhances fuel efficiency by cleansing the fuel and exhaust systems, resulting in cost savings.

  • Emission Reduction: Significantly lowers emissions, helping your vehicle comply with environmental legislation.

  • MOT Compliance: Assists in passing emissions tests, crucial for vehicle inspection success.

  • Engine Protection: Prolongs the life of your catalytic converter by reducing carbon build-up.

  • Versatile Use: Suitable for both petrol and diesel engines, making it a versatile addition to any car maintenance regimen.

  • Easy Application: Convenient 500ML bottle designed for straightforward engine application.

��

��

Catalan offer a ���MoneyBack Guarantee��� if your vehicle fails its��� MOT due to emissions, simply head to https://cataclean.com/motterms/ to find out how to claim!

Invest in CATACLEAN - Hybrid Catalytic Cleaner - 500ML to ensure your vehicle operates efficiently while supporting environmental sustainability. This catalytic cleaner is an essential tool for those aiming to reduce their carbon footprint and maintain their vehicle���s performance.

��

Info

Size

500ML

Brand

CATACLEAN

Warranty

Money Back Guarantee

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!