Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
GYEON

GYEON - Ultimate Detailing Bundle

Part: GYEONBUNDLE0

stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£89.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

GYEON - Ultimate Detailing Bundle

Elevate your car care game with the ultimate detailing kit from Q²M – a powerhouse collection designed for precision, protection, and perfection. From the slick, hydrophobic finish of Bathe+ and WetCoat to the deep-cleaning strength of Iron Wheel Cleaner and Bug & Grime, every product is engineered to deliver professional results at home. Paired with ultra-soft, paint-safe towels and pads, and streak-free glass and interior cleaners, this kit is your all-in-one solution for a flawless, showroom-worthy finish every time.

This kit includes:

  • Q2M Soft Wipe Evo 
    SoftWipe EVO was redeveloped to suit the softest paints on the market. It's extremely thick, but its gentle fibers are perfect for wiping coatings and all types of quick detailers and spray sealants.

  • Q2M Glass Wipe 
    GlassWipe EVO is the most effective way to clean your glass streak and smudge free.
  • Q2M Bug & Grime
    Bug & Grime is a strong and very efficient pre-wash product developed specially for the removal of insects, bugs and grime. It dissolves contamination and ensures safe and scratch-free wash afterwards.
  • Q2M Glass - 500ml
    Q²M Glass is the ultimate formula for fast, effortless and effective cleaning of all automotive glass surfaces. Removes oily residue and instantly leaves a smudge free finish. Easy to use and safe for all interior materials like leather, vinyl or alcantara.
  • Q2M Iron Wheel Cleaner Redefined - 500ml
    Dedicated & highly effective cleaner for all types of wheels and finishes.A powerful formula redefined to remove efficiently grime, dirt and brake dust. SAFE & EFFICIENT The Q²M Iron Wheel Cleaner Redefined has a gel consistency, clings to the surface extremely well and both loosens and dissolves dirt particles. 

  • Q2M Interior Detailer - 500ml
    InteriorDetailer has an alcohol-based formula (60%), which removes the majority of organic contaminants from any surface.

  • Q2M Bathe - 500ml
    Q²M Bathe+ is the world’s first pH-neutral shampoo containing SiO₂. Even a quick wash leaves a strong hydrophobic layer, repelling water and dirt and deferring the need for the next wash. The wash is an absolute joy, while the shampoo is very slick

  • Q2M Wet Coat - 500ml
    WetCoat is an instant, brilliantly easy to use hydrophobicity booster. It's ready to use formula, giving outstanding results in a simple and quick spray on/rinse off process.

  • Q2M Washpad Evo
    WashPad EVO ensures an effective wash procedure while being safe on any exterior surface. Two different materials make it efficient on both light and strongly contaminated cars. The plush side features now a selection of 3 different types of fibres and has a GSM of 1250.

Fitment Info

Brand

GYEON

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!