Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Brake Pads

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
brembo

BREMBO - Brake Pad Set - Front

Part: BREP85075

(5)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£37.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BREMBO - Brake Pad Set - Front

The BREMBO - Front Brake Pads (BREP85075), offer top-tier braking performance. Designed to set new standards in safety and control for your vehicle. These brake pads leverage BREMBO’s industry-leading technology to provide exceptional braking efficiency across various driving conditions, ensuring your vehicle stops exactly when you need it to. The high-performance stopping power showcases responsive and precise braking, empowered by cutting-edge engineering that BREMBO is renowned for. Matched to original equipment (OE) specifications, these brake pads promise seamless integration with your vehicle's brake system, ensuring a snug fit and optimal functionality.

Features:

  • High-Performance Stopping Power: Experience the ultimate in braking responsiveness and control with BREMBO's advanced technology, ensuring your vehicle stops precisely when you need it.
  • OE Quality Match: Designed to meet and exceed original equipment specifications, these brake pads provide the perfect fit and seamless integration with your vehicle's brake system.
  • Durable and Long-Lasting: Constructed with premium materials to ensure longevity and resistance to wear, offering consistent performance throughout their lifespan.
  • Low Dust Formula: Enjoy cleaner wheels and reduced maintenance with a low dust formulation that minimizes brake pad residue.
  • Enhanced Safety Features: Equipped with cutting-edge technologies to reduce noise and vibrations, ensuring a quiet and smooth braking experience.
  • Wide Compatibility: Suitable for a wide range of vehicle models, offering flexibility and convenience for diverse automotive needs.

 

Constructed from premium materials, BREMBO Front Brake Pads are built for durability and long-lasting performance. This robust construction ensures minimal wear and tear, maintaining consistent braking throughout their lifespan and significantly reducing the need for frequent replacements. The low dust formulation enhances the cleanliness of your wheels, decreasing maintenance efforts and keeping your vehicle looking its best. With advanced safety features that include noise reduction and vibration minimisation, these brake pads offer a smooth, quiet braking experience that enhances driver comfort and safety. Suitable for a wide range of vehicle models, BREMBO Front Brake Pads provide flexibility and convenience, catering to diverse automotive needs.

Fitment Info

Brand

brembo

Thickness (mm)

20

Number of Wear Indicators

1

Height 1 (mm)

66

Height 2 (mm)

71

Wear Warning Contact

incl. wear warning contact

Additional Info

with anti-squeak plate

Brake System

Teves

Warning Contact Length (mm)

145

Width 1 (mm)

155

Width 2 (mm)

157

WVA Number

23588

Unique Reference

ZA010188

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!