Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

Brake Pads

Tu Vehículo Actual

UK
O
Seleccionar Marca
Seleccionar Modelo
Seleccionar Año
Seleccionar Motor
brembo

BREMBO - Brake Pad Set - Front

Parte: BREP85075

(2)
stock status

En Stock

  • Timeline
    Entrega a Domicilio Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£39.59

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

BREMBO - Brake Pad Set - Front

The BREMBO - Front Brake Pads (BREP85075), offer top-tier braking performance. Designed to set new standards in safety and control for your vehicle. These brake pads leverage BREMBO’s industry-leading technology to provide exceptional braking efficiency across various driving conditions, ensuring your vehicle stops exactly when you need it to. The high-performance stopping power showcases responsive and precise braking, empowered by cutting-edge engineering that BREMBO is renowned for. Matched to original equipment (OE) specifications, these brake pads promise seamless integration with your vehicle's brake system, ensuring a snug fit and optimal functionality.

Features:

  • High-Performance Stopping Power: Experience the ultimate in braking responsiveness and control with BREMBO's advanced technology, ensuring your vehicle stops precisely when you need it.
  • OE Quality Match: Designed to meet and exceed original equipment specifications, these brake pads provide the perfect fit and seamless integration with your vehicle's brake system.
  • Durable and Long-Lasting: Constructed with premium materials to ensure longevity and resistance to wear, offering consistent performance throughout their lifespan.
  • Low Dust Formula: Enjoy cleaner wheels and reduced maintenance with a low dust formulation that minimizes brake pad residue.
  • Enhanced Safety Features: Equipped with cutting-edge technologies to reduce noise and vibrations, ensuring a quiet and smooth braking experience.
  • Wide Compatibility: Suitable for a wide range of vehicle models, offering flexibility and convenience for diverse automotive needs.

 

Constructed from premium materials, BREMBO Front Brake Pads are built for durability and long-lasting performance. This robust construction ensures minimal wear and tear, maintaining consistent braking throughout their lifespan and significantly reducing the need for frequent replacements. The low dust formulation enhances the cleanliness of your wheels, decreasing maintenance efforts and keeping your vehicle looking its best. With advanced safety features that include noise reduction and vibration minimisation, these brake pads offer a smooth, quiet braking experience that enhances driver comfort and safety. Suitable for a wide range of vehicle models, BREMBO Front Brake Pads provide flexibility and convenience, catering to diverse automotive needs.

Fitment Info

Brand

brembo

Position

Front

Type

Brake Pad

Width

155 - 157mm

Thickness

20mm

Height

66m

Braking System

Teves

Wear indicator

Electric

Unique Reference

ZA010188

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!