Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

Engine Oil

Your Current Vehicle

UK
Or
Select Make
Select Model
Select Year
Select Engine
MOBIL

MOBIL - Engine Oil ESP 5W30 - 1L

Part: MOB157293

(3)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£12.91£16.99

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

MOBIL - Engine Oil ESP 5W30 - 1L

Mobil 1™ ESP 5W-30 exemplifies advanced engine protection, crafted to cater to Euro 6 and prior gasoline and diesel-powered automobiles. This engine oil is meticulously engineered to meet or exceed the stringent requirements set by leading car manufacturers, making it an expert choice for modern vehicle maintenance. The low ash content of Mobil 1™ ESP 5W-30 is designed to minimise particulate build-up in Diesel Particulate Filters (DPF), contributing to enhanced engine efficiency and longevity. Furthermore, its low sulphur and phosphorous composition helps prevent the poisoning of Gasoline Catalytic Converters, allowing your vehicle to operate at peak performance and maintain compliance with environmental standards. Employing active cleaning agents, Mobil 1™ ESP 5W-30 effectively reduces deposits and sludge build-up, ensuring a clean engine and extending its longevity. The oil's excellent thermal and oxidative stability plays a vital role in reducing oil aging, thus offering prolonged drain interval protection—a feature invaluable to both retail customers and professional garages keen on maximising vehicle uptime. Furthermore, Mobil 1™ ESP 5W-30 boasts excellent low-temperature capabilities, facilitating quick cold weather starting and rapid protection, thereby extending engine life even in harsh conditions. Meeting the industry's latest Low-Speed Pre-Ignition (LSPI) requirements for gasoline direct injection turbocharged engines, Mobil 1™ ESP 5W-30 is a dependable solution to prevent engine breakdowns caused by pre-ignition occurrences at low speeds and high torque operations.

Features:

  • Low Ash Content: Reduces particulate build-up in Diesel Particulate Filters, ensuring system efficiency.
  • Low Sulphur and Phosphorous Content: Prevents poisoning of Gasoline Catalytic Converters for optimal performance.
  • Active Cleaning Agents: Minimises deposits and sludge build-up for a clean and long-lasting engine.
  • Thermal and Oxidative Stability: Prolongs oil life, allowing extended drain intervals.
  • Excellent Low-Temperature Capabilities: Ensures quick start-up and protection in cold weather, extending engine life.
  • Meets LSPI Requirements: Protects turbocharged engines from pre-ignition damage, ensuring reliability.

 

Choosing a high-quality engine oil is crucial for maintaining your vehicle's peak performance and longevity. Premium engine oils provide excellent lubrication, which minimises friction among moving components. This reduction in friction not only prevents wear and tear on the engine but also enhances fuel efficiency, yielding long-term cost savings. High-quality oils possess quality thermal stability and viscosity, ensuring optimal engine performance across a broad range of temperatures and driving conditions. Furthermore, they effectively disperse contaminants and help maintain engine cleanliness, preventing sludge buildup that can impair engine function. By investing in a quality engine oil, you are ensuring the reliability and efficiency of your vehicle, avoiding potential breakdowns, and experiencing a smoother, more responsive drive.

 

 

 

Fitment Info

Size

1L

Type

Synthetic Oil

ACEA

C3

Brand

MOBIL

Sub Brand

Mobil 1 ESP 5W-30

Capacity (Litre)

1

Viscosity

5W-30

Grade

5W-30

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!