Truck

Free Delivery For orders above £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Free Click & Collect For all orders

POWATEC

POWATEC - Engine Flush

Part: PWTPWT1001

(3)
stock status

In Stock

  • Timeline
    Home Delivery Available
  • Timeline
    Free Click & Collect
  • Map
    Check Local Stock

£10.39

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

POWATEC - Engine Flush

Experience outstanding engine care with POWATEC Engine Flush, a premium formula designed to revitalise and protect your vehicle’s heart. Renowned for its high-quality engineering, POWATEC delivers a solution that penetrates deeply into the lubricating system to dissolve stubborn deposits and contaminants, ensuring optimal engine cleanliness and performance.

Advanced technology supports compatibility with both petrol and diesel engines, enhancing maintenance routines effortlessly.

Features:

  • Versatile Use: Suitable for petrol and diesel engines
  • Comprehensive Cleaning: Effectively removes resin and residue
  • Engine Protection: Neutralises harmful acids to prevent damage
  • Ease of Use: Simple addition before oil change
  • Efficiency-Driven: Treats up to 6 litres of oil


Reliable performance and consistent quality combine to support engine longevity and smooth operation. Trust in a solution designed to uphold vehicle health through thorough maintenance and enhanced engine efficiency.

Info

Brand

POWATEC

No OE Number & Cross Reference data available for this part.

Newsletter

Join the GSF VIP Club!

And receive exclusive deals and more direct to your inbox!