Truck

Envío Gratis Para pedidos superiores a £25

Kalarna

Klarna - Pay in 30 Days

clickPointer

Click & Collect Gratis Para todos los pedidos

AUTOBRITE

AUTOBRITE - Elegance 500ML

Parte: ATBADELEG500M138

stock status

Disponible - Sólo colección

  • Timeline
    Entrega a Domicilio No Disponible
  • Timeline
    Click & Collect Gratis
  • Map
    Verificar Stock

£15.13

paypalklarnavisamastercardapplepaygoolglepayamexclearPay

AUTOBRITE - Elegance 500ML

ELEGANCE

Elegance Luxurious Car Detailing Spray

Luxury in a bottle! That’s Elegance!

Elegance luxurious car detailing spray can be used on both the inside and outside of your vehicle. Application is a simple spray and wipe, for use on interior plastics spray Elegance onto a microfibre towel and wipe over the surface to leave a clean looking matt finish with a luxurious scent. For exterior surfaces apply a light mist and buff until residue disappears.

Elegance is extremely good on gloss interior trim, and aluminium accents for a glossy, streak free finish.

FEATURES
A luxurious detailing gloss spray with a fantastic luxury scent.
Safe on all surfaces - will not degrade waxes or sealants
Ideal on Lacquered wood, alloy wheels, paintwork, glass, trim and even leather
Cleans, conditions and protects
Lovely smoothness and slick finish

DESCRIPTION
Elegance is a versatile all-round car detailing spray, adding extra gloss to paintwork and leaving a luxurious slick finish.

Elegance provides you with ultimate gloss on all painted and gloss surfaces. Ideal for helping buff off waxes and sealants, and for removing small fingerprints and smudges. Elegance can also be used on other automotive surfaces including lacquered wood, alloy wheels, glass, leather, plastic trim, interior dash and plastics, stainless steel and even Matt Wrap!. Elegance is also suitable for satin painted and satin wrapped surfaces as well as interior plastics and won’t leave a patchy or sticky finish.

Elegance will not degrade waxes and sealants and will add to existing protection. It can even be applied wet to a freshly washed car to help with drying too.

Info

Brand

AUTOBRITE

No hay datos de número OE ni de referencia cruzada disponibles para esta pieza.

Newsletter

¡Únete al Club VIP de GSF!

¡Y recibe ofertas exclusivas y más directamente en tu bandeja de entrada!